Insufficient Evidencenot manually reviewedcatalog importevidence: source-scanned

core-refinery

Find the core that runs through everything — the ideas that survive across all your sources.

52
overall score
Publisher
Version
source-scanned
Updated
2026-03-15
Tags
web-and-frontend-developmentawesome-indexcatalog-only

Source-aware scan found normal operational surface via environment, network, or shell-related references.

Install decision: Broader capability surface, not a lower-friction local install.
Caution signal
Privileged but not suspicious by default
Review state
Static analysis only
Evidence points
17
Capability surface
4 capability signals
evidence snapshotnot tested yetnot tested yetno manual review yetsource-scanned evidence
Top row only: current live test result, deeper follow-on result, review presence, and evidence level. Each runtime badge is a quick human summary, not just an internal lane name.

✉️ Quick review

No runtime postcard yet for this skill. Static evidence is available below, but the runtime lane has not touched it yet.

Evidence strengthStronger evidence: source-level scan available
Evidence basisSource-aware static scan of the upstream skill repo
Current runtime resultNo live runtime receipt yet, so the page is still relying on static evidence only.

Before you install

✅ Good fit if...
  • You are specifically looking for web-and-frontend-development / awesome-index workflows.
🧰 Before you install...
  • Expect setup work: this skill references 10 env vars.
  • Assume outside service calls are part of the story: 5 external domain references showed up.
  • Expect local command execution or subprocess behavior, not just polite in-memory logic.
⚠️ Watch out for...
  • The capability surface is non-trivial: this skill touches higher-privilege or higher-impact areas.
  • No runtime verdict yet, so you are leaning harder on static evidence and documentation quality.

Why this label

This landed in Insufficient Evidence because the imported entry still does not have enough direct proof to justify a stronger trust call.

Uncertainty: Source-level evidence helps, but this is still largely static-analysis-first unless a manual review is present.

Evidence strengthStronger evidence: source-level scan available
Suspicious signals0
Higher-impact signals0
Env / secret refs10
Network refs5
Shell signals1

Capability surface and suspicious signals

Capability surface

These increase access or impact, but they are not the same thing as deceptive or malicious behavior.

env vars: 10external refs: 5shell / subprocess usefile write signals

Capability summary

Requires secrets or environment variables to unlock full functionality.References external services or network endpoints.Can invoke shell commands or subprocess-style behavior.
+ 1 more
Contains signs of writing, publishing, or persisting output.

Suspicious behaviors

These are the signals that count much more heavily against the score.

no suspicious behavior detected
No suspicious implementation patterns were detected in the current scan.

Evidence

Env vars
CANDIDATESDOMAINGOLDEN
+ 7 more
GPTINVLLMMASTERMETRICSSPECIFICSYNTHESIS
Domains
github.com/clawdbot/skills/commit/972f32f6256060f68be76cf88515dac3de5c0406github.com/live-neon/skills/tree/main/pbd/core-refinerygithub.com/openclaw/skills/commit/433686de5f28b3c0e0c1c6f15a3f1e386dddd0e2
+ 2 more
github.com/openclaw/skills/commit/d303b8f2f68240f8045b1fe0f3549d61bb89f8c8github.com/openclaw/skills/commit/ee2a50a2fdc6aef804c64d008bc79dfe9b6d38f7
Binaries
gh
Shell signals
sh
Suspicious
None detected

Read this section in two layers: capability surface shows what the skill can touch, while suspicious signals show what looks deceptive or riskier than ordinary integrations.

🧪 Technical runtime details

No runtime suite recorded yet for this skill.

Publisher and provenance

Listed in the VoltAgent awesome-openclaw-skills catalog under Web And Frontend Development and lightly source-scanned from openclaw/skills. This is stronger evidence than catalog metadata alone, but still not a full runtime audit.

Source type: awesome-index

Source path: https://github.com/openclaw/skills/tree/main/skills/leegitw/core-refinery/SKILL.md

Source URL: https://github.com/openclaw/skills/tree/main/skills/leegitw/core-refinery/SKILL.md

Discovery category: Web And Frontend Development

Manual review

No human review yet. The scorecard is currently static-analysis-first.

Community signals

Community signals

These are community attention markers, not crowd-sourced truth. Click what feels especially worth flagging or reviewing.

Related skills